Structure of PDB 5v6m Chain L Binding Site BS01

Receptor Information
>5v6m Chain L (length=219) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQVLTQTPSSVSAAVGGTVTIKCQSSQSVYPNNNLGWYQQKPGQPPKLLI
YEASTLASGVPSRFKGSGSGTQFTLTISDLECDDAATYYCLGAYDFTVAE
GAAFGGGTEVVVKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA
KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC
EVTHQGLSSPVTKSFNRGE
Ligand information
>5v6m Chain P (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRKSIHIGPGRAF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v6m Increased epitope complexity correlated with antibody affinity maturation and a novel binding mode revealed by structures of rabbit antibodies against the third variable loop (V3) of HIV-1 gp120.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y28 N32 Y49 E50 L89 A91 Y92 D93 F94 T95
Binding residue
(residue number reindexed from 1)		Y30 N34 Y51 E52 L91 A93 Y94 D95 F96 T97
External links