Structure of PDB 5uz9 Chain L Binding Site BS01

Receptor Information
>5uz9 Chain L (length=189) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTMDHYLDIRLRPDPEFPPAQLMCVLFGKLHQALVAQGGDRIGVSFPDLD
ESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYR
QVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRS
QSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Ligand information
>5uz9 Chain M (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuaagaaauucacggcgggcuugauguccgcgucuaccugguucacugcc
guauaggcag
..............................................<...
........>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uz9 Structure Reveals Mechanisms of Viral Suppressors that Intercept a CRISPR RNA-Guided Surveillance Complex.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R111 L146 S148 Q149 S150 R156
Binding residue
(residue number reindexed from 1)		R113 L148 S150 Q151 S152 R158
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5uz9, PDBe:5uz9, PDBj:5uz9
PDBsum5uz9
PubMed28340349
UniProtQ02MM2|CAS6_PSEAB CRISPR-associated endonuclease Cas6/Csy4 (Gene Name=cas6f)

[Back to BioLiP]