Structure of PDB 5nrl Chain L Binding Site BS01

Receptor Information
>5nrl Chain L (length=109) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REEYAEQARPIELQALKSKYTNYDHLIKGSLKDLNKRKLSFKRGKKFGFY
CDICNLTFKDTLQYIDHLNHKVHAIKFENLFDEPLIIDVPQEEFELCYHN
LIKDFVEVR
Ligand information
>5nrl Chain 6 (length=95) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaacuucguggacauuuggucaauuugaaacaauacagagauca
gcaguuccccugcauaaggaugaaccguucaaagagauuuguuuu
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nrl Structure of a pre-catalytic spliceosome.
Resolution7.2 Å
Binding residue
(original residue number in PDB)		S71 K90 D91 H101
Binding residue
(residue number reindexed from 1)		S40 K59 D60 H70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
PDBsum5nrl
PubMed28530653
UniProtQ12368|SNU23_YEAST 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component (Gene Name=SNU23)

[Back to BioLiP]