Structure of PDB 5mv4 Chain L Binding Site BS01

Receptor Information

>5mv4 Chain L (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVKLEESGGGLVQPGGSMKLSCAASGFTFSDAWMDWVRQSPEKGLEWVAE
IRNKVNNHATNYAESVKGRFTISRDDSRSVVYLQMNNLKPEDTGIYYCTG
LTFDYWGQGTTLTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEP
VTLTWNSGSLSSGVHTFPALLLSGLYTLSSSVTVTSNTWPSQTITCNVAH
PASSTKVDKKIEPRGP

Ligand information

>5mv4 Chain N (length=12) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PGERGETGPPGP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mv4 Anti-citrullinated protein antibodies cause arthritis by cross-reactivity to joint cartilage.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	D31 A32 W33 N53 L101 T102 F103 D104
Binding residue (residue number reindexed from 1)	D31 A32 W33 N53 L101 T102 F103 D104

External links

PDB	RCSB:5mv4, PDBe:5mv4, PDBj:5mv4
PDBsum	5mv4
PubMed	28679953

[Back to BioLiP]