Structure of PDB 5ms0 Chain L Binding Site BS01

Receptor Information
>5ms0 Chain L (length=139) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRE
LLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPY
KVAINEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK
Ligand information
>5ms0 Chain R (length=29) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucuuuaaaaauaagcccugaagaagggc
..............<<<<<.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ms0 Structural basis for lambda N-dependent processive transcription antitermination.
Resolution9.8 Å
Binding residue
(original residue number in PDB)		K101 V102 D118 K121 N124
Binding residue
(residue number reindexed from 1)		K101 V102 D118 K121 N124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ms0, PDBe:5ms0, PDBj:5ms0
PDBsum5ms0
PubMed28452979
UniProtP0A780|NUSB_ECOLI Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]