Structure of PDB 5mps Chain L Binding Site BS01

Receptor Information

>5mps Chain L (length=155) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWE
IMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGYE
KLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCR
GCAST

Ligand information

>5mps Chain 6 (length=99) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuuau

<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>....................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mps Structure of a spliceosome remodelled for exon ligation.
Resolution	3.85 Å
Binding residue (original residue number in PDB)	K40 L41 A42 T98 G99 K102 T114 N115 S118 T119 C120 I121 R123 V124 P125 C145 V146 H147 S155 T156
Binding residue (residue number reindexed from 1)	K39 L40 A41 T97 G98 K101 T113 N114 S117 T118 C119 I120 R122 V123 P124 C144 V145 H146 S154 T155

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000282	cellular bud site selection
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005686	U2 snRNP

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mps, PDBe:5mps, PDBj:5mps
PDBsum	5mps
PubMed	28076345
UniProt	P25337\|BUD31_YEAST Pre-mRNA-splicing factor BUD31 (Gene Name=BUD31)

[Back to BioLiP]