Structure of PDB 5mp3 Chain L Binding Site BS01

Receptor Information

>5mp3 Chain L (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSP
KLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSFYL
RTFGGGTKLDIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VRWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNRNE

Ligand information

>5mp3 Chain D (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KHVPGGGSV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mp3 Crystal structure of DC8E8 Fab in the complex with a 30-mer tau peptide at pH 6.5
Resolution	2.75 Å
Binding residue (original residue number in PDB)	Y38 S97 F98 Y99 L100 R101
Binding residue (residue number reindexed from 1)	Y38 S97 F98 Y99 L100 R101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:5mp3, PDBe:5mp3, PDBj:5mp3
PDBsum	5mp3
PubMed
UniProt	Q52L64

[Back to BioLiP]