Structure of PDB 5mdx Chain L Binding Site BS01

Receptor Information
>5mdx Chain L (length=36) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSNPNEQSVELNRTSLYWGLLLIFVLAVLFSNYFFN
Ligand information
>5mdx Chain M (length=29) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NILAFIATALFILVPTAFLLIIYVKTVSQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mdx Subunit and chlorophyll organization of the plant photosystem II supercomplex.
Resolution5.3 Å
Binding residue
(original residue number in PDB)		S10 V11 E12 L13 R15 L18
Binding residue
(residue number reindexed from 1)		S8 V9 E10 L11 R13 L16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mdx, PDBe:5mdx, PDBj:5mdx
PDBsum5mdx
PubMed28604725
UniProtP60129|PSBL_ARATH Photosystem II reaction center protein L (Gene Name=psbL)

[Back to BioLiP]