Structure of PDB 5j0n Chain L Binding Site BS01

Receptor Information

>5j0n Chain L (length=94) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGS
FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

Ligand information

>5j0n Chain A (length=197) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtcggcatagtgactgcatatgttgtgttttacagtattatgtagtctgt
tttttatgcaaaatctaatttaatatattgatatttatatcattttacgt
ttctcgttcagctttaatacaataagttggaattctaaaaaagcattgct
tatcaatttgttgcaacgaacaggtcactatcagtcaaaatattgat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5j0n Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
Resolution	11.0 Å
Binding residue (original residue number in PDB)	R42 E44 R46 R59 G61 R62 N63 P64 V70 L72
Binding residue (residue number reindexed from 1)	R42 E44 R46 R59 G61 R62 N63 P64 V70 L72

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0030527	structural constituent of chromatin
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0006417	regulation of translation

	Cellular Component
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:1990177	IHF-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5j0n, PDBe:5j0n, PDBj:5j0n
PDBsum	5j0n
PubMed	27223329
UniProt	P0A6Y1\|IHFB_ECOLI Integration host factor subunit beta (Gene Name=ihfB)

[Back to BioLiP]