Structure of PDB 5g04 Chain L Binding Site BS01

Receptor Information

>5g04 Chain L (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLET
YWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNF
HNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTH
MRQIKIYTPVEESSIGKFPCTTIDFMMYRSIR

Ligand information

>5g04 Chain S (length=10) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RAALSDITNS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5g04 Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
Resolution	3.9 Å
Binding residue (original residue number in PDB)	E87 Y89 Q146 N147
Binding residue (residue number reindexed from 1)	E85 Y87 Q144 N145

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0007346	regulation of mitotic cell cycle
GO:0016567	protein ubiquitination
GO:0031145	anaphase-promoting complex-dependent catabolic process
GO:0051301	cell division
GO:0051445	regulation of meiotic cell cycle
GO:0070936	protein K48-linked ubiquitination
GO:0070979	protein K11-linked ubiquitination
GO:0141198	protein branched polyubiquitination

	Cellular Component
GO:0005654	nucleoplasm
GO:0005680	anaphase-promoting complex
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5g04, PDBe:5g04, PDBj:5g04
PDBsum	5g04
PubMed	27120157
UniProt	Q9UM13\|APC10_HUMAN Anaphase-promoting complex subunit 10 (Gene Name=ANAPC10)

[Back to BioLiP]