Structure of PDB 5eor Chain L Binding Site BS01

Receptor Information
>5eor Chain L (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIDWYQQQPLKPPKYVMEL
RRDGSHNTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKE
QFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSP
SGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFT
CQVTHEGDTVEKSLSPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eor Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
Resolution2.27 Å
Binding residue
(original residue number in PDB)		T31 Y32 T33 D35 E50 G96 D97 T98 F103
Binding residue
(residue number reindexed from 1)		T30 Y31 T32 D34 E49 G95 D96 T97 F102
External links