Structure of PDB 5a31 Chain L Binding Site BS01

Receptor Information
>5a31 Chain L (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLET
YWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNF
HNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTH
MRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a31 Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		K84 E87 S88 Y89 N147 R149 D150
Binding residue
(residue number reindexed from 1)		K82 E85 S86 Y87 N145 R147 D148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0031145 anaphase-promoting complex-dependent catabolic process
GO:0051301 cell division
GO:0051445 regulation of meiotic cell cycle
GO:0070936 protein K48-linked ubiquitination
GO:0070979 protein K11-linked ubiquitination
GO:0141198 protein branched polyubiquitination
Cellular Component
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a31, PDBe:5a31, PDBj:5a31
PDBsum5a31
PubMed26083744
UniProtQ9UM13|APC10_HUMAN Anaphase-promoting complex subunit 10 (Gene Name=ANAPC10)

[Back to BioLiP]