Structure of PDB 4zp3 Chain L Binding Site BS01

Receptor Information
>4zp3 Chain L (length=43) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREAR
Ligand information
>4zp3 Chain O (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDAELVRLSKRLVENAVLKAVQQYLEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zp3 AKAP18:PKA-RII alpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA.
Resolution2.63 Å
Binding residue
(original residue number in PDB)		V20 Q24
Binding residue
(residue number reindexed from 1)		V20 Q24
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4zp3, PDBe:4zp3, PDBj:4zp3
PDBsum4zp3
PubMed27102985
UniProtP13861|KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit (Gene Name=PRKAR2A)

[Back to BioLiP]