Structure of PDB 4z88 Chain L Binding Site BS01

Receptor Information
>4z88 Chain L (length=68) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEFRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYW
GELRGRRGYVPHNMVSEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z88 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		Y1326 P1333 N1334 D1336 D1359 F1361 Y1372 P1374
Binding residue
(residue number reindexed from 1)		Y13 P20 N21 D23 D46 F48 Y59 P61
Enzymatic activity
Enzyme Commision number ?
External links