Structure of PDB 4xln Chain L Binding Site BS01

Receptor Information
>4xln Chain L (length=347) Species: 271 (Thermus aquaticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQEL
IREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHI
AREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEK
FEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTAR
QLQQELGREPSYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKD
SFYGDFIPDENLPSPVEAAAQSLLSEELEKALSKLSEREAMVLKLRKGLI
DGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE
Ligand information
>4xln Chain R (length=48) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cttgacaaaagtgttaaattgtgctatactgggagctgtcacggatgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xln Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		V96 R97 L100 H101 G104 L108 N206 R208 L209 S212 K215 F224 R237 K241 F242 E243 R246 F248 K249 S251 T252 Y253 T255 W256 W257 Q260 R264 R274 P276 V277 H278 R379 V407 T408 R411
Binding residue
(residue number reindexed from 1)		V5 R6 L9 H10 G13 L17 N115 R117 L118 S121 K124 F133 R146 K150 F151 E152 R155 F157 K158 S160 T161 Y162 T164 W165 W166 Q169 R173 R183 P185 V186 H187 R288 V316 T317 R320
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xln, PDBe:4xln, PDBj:4xln
PDBsum4xln
PubMed26349032
UniProtQ9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]