Structure of PDB 4u39 Chain L Binding Site BS01

Receptor Information
>4u39 Chain L (length=30) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVVLVGKAWEIRAKLKEYGRTFQYVKDWIS
Ligand information
>4u39 Chain P (length=21) Species: 1423 (Bacillus subtilis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VVLVGKAWEIRAKLKEYGRTF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u39 Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis
Resolution3.194 Å
Binding residue
(original residue number in PDB)		W17 R20 A21
Binding residue
(residue number reindexed from 1)		W9 R12 A13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030435 sporulation resulting in formation of a cellular spore

View graph for
Biological Process
External links
PDB RCSB:4u39, PDBe:4u39, PDBj:4u39
PDBsum4u39
PubMed
UniProtL8EBJ9|MCIZ_BACSU Cell division inhibitor MciZ (Gene Name=mciZ)

[Back to BioLiP]