Structure of PDB 4ob5 Chain L Binding Site BS01

Receptor Information

>4ob5 Chain L (length=112) Species: 9606 (Homo sapiens)

MEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLI
YGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTF
GQGTKVEIKRLV

Ligand information

• Ligand ID: TMO
• InChI: InChI=1S/C3H9NO/c1-4(2,3)5/h1-3H3
• InChIKey: UYPYRKYUKCHHIB-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.370
  OpenEye OEToolkits 1.7.0: C[N+](C)(C)[O-]
  ACDLabs 12.01: [O-][N+](C)(C)C
• Formula: C3 H9 N O
• Name: trimethylamine oxide
• ZINC: ZINC000000895494
• PDB chain: 4ob5 Chain L Residue 204

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ob5 Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
• Resolution: 1.7 Å
• Binding residue (original residue number in PDB): A55 T56
• Binding residue (residue number reindexed from 1): A57 T58
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003823 antigen binding

Biological Process

• GO:0002250 adaptive immune response
• GO:0003094 glomerular filtration
• GO:0006955 immune response
• GO:0019731 antibacterial humoral response

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005886 plasma membrane
• GO:0019814 immunoglobulin complex
• GO:0070062 extracellular exosome
• GO:0071748 monomeric IgA immunoglobulin complex
• GO:0071751 secretory IgA immunoglobulin complex
• GO:0071756 pentameric IgM immunoglobulin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:4ob5, PDBe:4ob5, PDBj:4ob5
• PDBsum: 4ob5
• PubMed: 25254371
• UniProt: P01619|KV320_HUMAN Immunoglobulin kappa variable 3-20 (Gene Name=IGKV3-20)