Structure of PDB 4n8c Chain L Binding Site BS01

Receptor Information
>4n8c Chain L (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMSQSPSSLAVSVGEKVSMSCKSSQSLFYSSYQKDLLAWYQQKPGQSP
KLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYFCQQYYTY
PLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDI
NVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTC
EATHKTSTSPIVKSFNRNE
Ligand information
>4n8c Chain X (length=15) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLLTEVETPIRNEWG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4n8c Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y31 Y34 Y97 Y100
Binding residue
(residue number reindexed from 1)		Y31 Y34 Y97 Y100
External links