Structure of PDB 4n0y Chain L Binding Site BS01

Receptor Information

>4n0y Chain L (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHN
NDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVF
GGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVA
WKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTH
EGSTVEKTVAPT

Ligand information

>4n0y Chain A (length=11) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TGHRMAWDMMM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4n0y Structure of Hepatitis C Virus Envelope Glycoprotein E1 Antigenic Site 314-324 in Complex with Antibody IGH526.
Resolution	1.749 Å
Binding residue (original residue number in PDB)	N31 W91 D93 N95A
Binding residue (residue number reindexed from 1)	N31 W91 D93 N96

External links

PDB	RCSB:4n0y, PDBe:4n0y, PDBj:4n0y
PDBsum	4n0y
PubMed	26135247

[Back to BioLiP]