Structure of PDB 4m1d Chain L Binding Site BS01

Receptor Information
>4m1d Chain L (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVLWYQQFPGTAPKLLIY
GNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYFCATWDSGLSADW
VFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT
VAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQV
THEGSTVEKTVAPTEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m1d Thermodynamic Signatures of the Antigen Binding Site of mAb 447-52D Targeting the Third Variable Region of HIV-1 gp120.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
Y32 W91 A95B W96
Binding residue
(residue number reindexed from 1)
Y33 W92 A98 W100
Enzymatic activity
Enzyme Commision number ?
External links