Structure of PDB 4jqi Chain L Binding Site BS01

Receptor Information
>4jqi Chain L (length=185) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIY
SASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFG
QGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWK
VSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH
Ligand information
>4jqi Chain V (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RTPPSLGPESCTTASSSLAKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jqi Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
S31 R67
Binding residue
(residue number reindexed from 1)
S31 R67
External links