Structure of PDB 4jo2 Chain L Binding Site BS01

Receptor Information
>4jo2 Chain L (length=216) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVLTQTPSSVSTAVGSAVTINCQSSQNVYSNNNLAWFQQKPGQPPRLLIY
DASKLASGVPSRFKGSGSGTQFTFTISDVQCDDAATFYCLGGYDCSSGDC
AAFGGGTEVVVRGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTV
TWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKV
TQGTTSVVQSFNRGDC
Ligand information
>4jo2 Chain P (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRKSIRIGPG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jo2 Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y28 N32 G91 Y92 C94
Binding residue
(residue number reindexed from 1)		Y29 N33 G92 Y93 C95
External links