Structure of PDB 4hs8 Chain L Binding Site BS01

Receptor Information

>4hs8 Chain L (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKL
LIYSASNHASGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCHQSKEAPY
AFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC

Ligand information

>4hs8 Chain A (length=12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QLINTNGSWHIN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4hs8 Glycan shifting on hepatitis C virus (HCV) e2 glycoprotein is a mechanism for escape from broadly neutralizing antibodies.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Y28 F32 S91 Y96
Binding residue (residue number reindexed from 1)	Y32 F36 S95 Y100

External links

PDB	RCSB:4hs8, PDBe:4hs8, PDBj:4hs8
PDBsum	4hs8
PubMed	23458406

[Back to BioLiP]