Structure of PDB 4hpo Chain L Binding Site BS01

Receptor Information
>4hpo Chain L (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFMLTQPHSVSESPGKTVTISCTRSSGSVASDYVQWYQQRPGSAPTTVVY
EDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNSSWV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT
HEGSTVEKTVAPT
Ligand information
>4hpo Chain P (length=15) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DKKQKVHALFYKLDI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hpo Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
Resolution1.694 Å
Binding residue
(original residue number in PDB)		A29 S30 D31 Y32 E50 D51 Y91 S94
Binding residue
(residue number reindexed from 1)		A30 S31 D32 Y33 E51 D52 Y94 S97
External links