Structure of PDB 3zrc Chain L Binding Site BS01

Receptor Information

>3zrc Chain L (length=143) Species: 9606 (Homo sapiens)

VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHS
YRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKER
CLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE

Ligand information

• Ligand ID: L8B
• InChI: InChI=1S/C21H22N4O5/c1-13-6-17(30-24-13)8-20(27)25-11-16(26)7-18(25)21(28)23-9-14-2-4-15(5-3-14)19-10-22-12-29-19/h2-6,10,12,16,18,26H,7-9,11H2,1H3,(H,23,28)/t16-,18+/m1/s1
• InChIKey: HFCLIEBJTGJKSV-AEFFLSMTSA-N
• SMILES:
  OpenEye OEToolkits 1.9.2: Cc1cc(on1)CC(=O)N2C[C@@H](C[C@H]2C(=O)NCc3ccc(cc3)c4cnco4)O
  CACTVS 3.385: Cc1cc(CC(=O)N2C[C@H](O)C[C@H]2C(=O)NCc3ccc(cc3)c4ocnc4)on1
  OpenEye OEToolkits 1.9.2: Cc1cc(on1)CC(=O)N2CC(CC2C(=O)NCc3ccc(cc3)c4cnco4)O
  CACTVS 3.385: Cc1cc(CC(=O)N2C[CH](O)C[CH]2C(=O)NCc3ccc(cc3)c4ocnc4)on1
  ACDLabs 12.01: O=C(N3C(C(=O)NCc2ccc(c1ocnc1)cc2)CC(O)C3)Cc4onc(c4)C
• Formula: C21 H22 N4 O5
• Name: (4R)-4-HYDROXY-1-[(3-METHYLISOXAZOL-5-YL)ACETYL]-N-[4-(1,3-OXAZOL-5-YL)BENZYL]-L-PROLINAMIDE
• ChEMBL: CHEMBL3108881
• ZINC: ZINC000095921112
• PDB chain: 3zrc Chain L Residue 1205

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3zrc Targeting the Von Hippel-Lindau E3 Ubiquitin Ligase Using Small Molecules to Disrupt the Vhl/Hif-1Alpha Interaction
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): W88 F91 Y98 P99 I109 H110 Y112 H115
• Binding residue (residue number reindexed from 1): W27 F30 Y37 P38 I48 H49 Y51 H54
• Annotation score: 1
• Binding affinity: BindingDB: IC50=4100nM,Kd=5300nM

External links

• PDB: RCSB:3zrc, PDBe:3zrc, PDBj:3zrc
• PDBsum: 3zrc
• PubMed: 22369643
• UniProt: P40337|VHL_HUMAN von Hippel-Lindau disease tumor suppressor (Gene Name=VHL)