Structure of PDB 3ujj Chain L Binding Site BS01

Receptor Information
>3ujj Chain L (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYELTQPPSVSVSPGQTARITCSGDALPEKYAYWYQQKSGQAPVLIIYED
SKRPSGIPERFSGSRSGTMATLTISGAQVDDEADYYCYSTNSGGTFFVFG
TGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE
GSTVEKTVAPTEC
Ligand information
>3ujj Chain P (length=17) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRKSIRIGPGQAFYATG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ujj Human Anti-V3 HIV-1 Monoclonal Antibodies Encoded by the VH5-51/VL Lambda Genes Define a Conserved Antigenic Structure.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		E30 K31 Y32 E50 G95 T95A F95B F96
Binding residue
(residue number reindexed from 1)		E29 K30 Y31 E49 G94 T95 F96 F97
External links