Structure of PDB 3pla Chain L Binding Site BS01

Receptor Information
>3pla Chain L (length=122) Species: 555311 (Saccharolobus solfataricus 98/2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVII
AEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILE
PGEAKDLVDEIIKRVNEIKGKT
Ligand information
>3pla Chain N (length=31) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuugugaugaaacacucauggucugaagac
...............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pla Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
Resolution3.15 Å
Binding residue
(original residue number in PDB)
E41 K44 R48
Binding residue
(residue number reindexed from 1)
E35 K38 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3pla, PDBe:3pla, PDBj:3pla
PDBsum3pla
PubMed21270896
UniProtD0KRE2

[Back to BioLiP]