Structure of PDB 3moa Chain L Binding Site BS01

Receptor Information
>3moa Chain L (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LQLTQSPSSLSASVGDRITITCRASQGVTSALAWYRQKPGSPPQLLIYDA
SSLESGVPSRFSGSGSGTEFTLTISTLRPEDFATYYCQQLHFYPHTFGGG
TRVDVRRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD
NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRGEC
Ligand information
>3moa Chain P (length=12) Species: 11708 (Human immunodeficiency virus type 1 (ZAIRE 6 ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ELLELDKWASLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3moa Crystal Structure of a Non-Neutralizing HIV-1 gp41 Envelope Antibody Demonstrates Neutralization Mechanism of gp41 Antibodies
Resolution2.3 Å
Binding residue
(original residue number in PDB)		L2 Q27 L91 H92 F93 Y94 H96
Binding residue
(residue number reindexed from 1)		L1 Q26 L90 H91 F92 Y93 H95
External links