Structure of PDB 3mlw Chain L Binding Site BS01

Receptor Information

>3mlw Chain L (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSVLTQPPSASGTPGQRVTISCSGNSSNIENNYVYWYQQLPGSTPKLLIF
RDDQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCASWDDSRGGPD
YVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAV
TVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPT

Ligand information

>3mlw Chain P (length=17) Species: 11696 (HIV-1 M:B_MN) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KRKRIHIGPGRAFYTTK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3mlw Conserved structural elements in the V3 crown of HIV-1 gp120.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	N30 N31 Y32 W91 D93 G95A G95B
Binding residue (residue number reindexed from 1)	N31 N32 Y33 W92 D94 G97 G98

External links

PDB	RCSB:3mlw, PDBe:3mlw, PDBj:3mlw
PDBsum	3mlw
PubMed	20622876

[Back to BioLiP]