Structure of PDB 3jcm Chain L Binding Site BS01

Receptor Information
>3jcm Chain L (length=139) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAER
VRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNK
LNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKR
Ligand information
>3jcm Chain C (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaaaauuaagguauguauu
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jcm The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
Resolution3.8 Å
Binding residue
(original residue number in PDB)		G96 G98 G129 N138
Binding residue
(residue number reindexed from 1)		G94 G96 G127 N136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jcm, PDBe:3jcm, PDBj:3jcm
PDBsum3jcm
PubMed26743623
UniProtQ06819|DIB1_YEAST Spliceosomal protein DIB1 (Gene Name=DIB1)

[Back to BioLiP]