Structure of PDB 3h3p Chain L Binding Site BS01

Receptor Information
>3h3p Chain L (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQRPGQAPRLLIY
GASSRPSGVADRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGQSLSTFG
QGTKVEVKL
Ligand information
>3h3p Chain S (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPNWFDITAQLWEFSQEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3h3p Interactions between lipids and human anti-HIV antibody 4E10 can be reduced without ablating neutralizing activity
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y92 G93 Q94 S95 S97
Binding residue
(residue number reindexed from 1)		Y92 G93 Q94 S95 S97
External links