Structure of PDB 3eyu Chain L Binding Site BS01

Receptor Information

>3eyu Chain L (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPK
LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP
LTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNRNEC

Ligand information

>3eyu Chain Q (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EFRHEA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3eyu Structures of Abeta-related peptide--monoclonal antibody complexes.
Resolution	2.71 Å
Binding residue (original residue number in PDB)	H31 N33 Y37 G96 H98 V99
Binding residue (residue number reindexed from 1)	H31 N33 Y37 G96 H98 V99

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3eyu, PDBe:3eyu, PDBj:3eyu
PDBsum	3eyu
PubMed	19385664
UniProt	A2NHM3

[Back to BioLiP]