Structure of PDB 2vwn Chain L Binding Site BS01

Receptor Information

>2vwn Chain L (length=44) Species: 9606 (Homo sapiens)

LCSLDNGDCDQFCHEVVCSCARGYTLAKACIPTGPYPCGKQTLE

Ligand information

• Ligand ID: H25
• InChI: InChI=1S/C22H20ClFN4O4S/c23-19-7-6-18(33-19)22(32)26-16-10-27(11-17(16)29)12-20(30)25-15-5-4-13(9-14(15)24)28-8-2-1-3-21(28)31/h1-9,16-17,29H,10-12H2,(H,25,30)(H,26,32)/t16-,17-/m0/s1
• InChIKey: ARAVOODWJJJNBY-IRXDYDNUSA-N
• SMILES:
  OpenEye OEToolkits 1.5.0: c1cc(c(cc1N2C=CC=CC2=O)F)NC(=O)CN3CC(C(C3)O)NC(=O)c4ccc(s4)Cl
  CACTVS 3.341: O[CH]1CN(C[CH]1NC(=O)c2sc(Cl)cc2)CC(=O)Nc3ccc(cc3F)N4C=CC=CC4=O
  OpenEye OEToolkits 1.5.0: c1cc(c(cc1N2C=CC=CC2=O)F)NC(=O)C[N@]3C[C@@H]([C@H](C3)O)NC(=O)c4ccc(s4)Cl
  CACTVS 3.341: O[C@H]1CN(C[C@@H]1NC(=O)c2sc(Cl)cc2)CC(=O)Nc3ccc(cc3F)N4C=CC=CC4=O
  ACDLabs 10.04: O=C(NC3C(O)CN(CC(=O)Nc2ccc(N1C=CC=CC1=O)cc2F)C3)c4sc(Cl)cc4
• Formula: C22 H20 Cl F N4 O4 S
• Name: 5-Chloro-thiophene-2-carboxylic acid ((3S,4S)-1-{[2-fluoro-4-(2-oxo-2H-pyridin-1-yl)-phenylcarbamoyl]-methyl}-4-hydroxy-pyrrolidin-3-yl)-amide
• ChEMBL: CHEMBL561318
• DrugBank: DB07875
• ZINC: ZINC000038995983
• PDB chain: 2vwn Chain A Residue 1245

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2vwn Design of Novel Aminopyrrolidine Factor Xa Inhibitors from a Screening Hit.
• Resolution: 1.61 Å
• Binding residue (original residue number in PDB): L137 E138
• Binding residue (residue number reindexed from 1): L43 E44
• Annotation score: 1
• Binding affinity: BindingDB: Ki=10nM

Enzymatic activity

• Enzyme Commision number: 3.4.21.6: coagulation factor Xa.

External links

• PDB: RCSB:2vwn, PDBe:2vwn, PDBj:2vwn
• PDBsum: 2vwn
• PubMed: 19200624
• UniProt: P00742|FA10_HUMAN Coagulation factor X (Gene Name=F10)