Structure of PDB 2v17 Chain L Binding Site BS01

Receptor Information

>2v17 Chain L (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVQITQSPSYLAASPGETITINCRASKSIRKFLAWYREKPGKTNKLLIYS
GSTLQSGTPSRFSGSGSGTDFTLTISRLEPEDFAMYYCQQHNDYPLTFGA
GTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKI
DGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPIVKSFNRNEC

Ligand information

>2v17 Chain A (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TDHGAE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2v17 X-Ray Structure of the Phf Core C-Terminus: Insight Into the Folding of the Intrinsically Disordered Protein Tau in Alzheimer'S Disease.
Resolution	1.65 Å
Binding residue (original residue number in PDB)	R30 F32 H91 N92 Y94
Binding residue (residue number reindexed from 1)	R30 F32 H91 N92 Y94

External links

PDB	RCSB:2v17, PDBe:2v17, PDBj:2v17
PDBsum	2v17
PubMed	18061582

[Back to BioLiP]