Structure of PDB 2qsc Chain L Binding Site BS01

Receptor Information

>2qsc Chain L (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSVLTQSPSSLSASVGDRVTITCQASQDISNYLNWYQHKPGKAPKLLIYT
ASNLETGVPSRFSGGGSGTHFSFTITSLQPEDAATYFCQQYDNLGDLSFG
GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK
VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ
GLSSPVTKSFNRGEC

Ligand information

>2qsc Chain P (length=15) Species: 11696 (HIV-1 M:B_MN) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RKRIHIGPGRAFYTT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2qsc Structure of antibody F425-B4e8 in complex with a V3 peptide reveals a new binding mode for HIV-1 neutralization.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Y32 Y91 D92 N93 L94
Binding residue (residue number reindexed from 1)	Y32 Y91 D92 N93 L94

External links

PDB	RCSB:2qsc, PDBe:2qsc, PDBj:2qsc
PDBsum	2qsc
PubMed	18068724

[Back to BioLiP]