Structure of PDB 2qhr Chain L Binding Site BS01

Receptor Information
>2qhr Chain L (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVLTQSSSASFSLGASAKLTCTLSRQHSTYTIEWYQQQPLKPPRYVMEL
KKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKE
QFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSP
SGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFT
CQVTHEGDTVEKSLSPAE
Ligand information
>2qhr Chain P (length=11) Species: 129000 (Ebola virus - Eckron (Zaire, 1976)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VEQHHRRTDND
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qhr Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Q27A Y31 T32 G91 D92 T93
Binding residue
(residue number reindexed from 1)		Q27 Y31 T32 G95 D96 T97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region
GO:0005886 plasma membrane

View graph for
Cellular Component
External links
PDB RCSB:2qhr, PDBe:2qhr, PDBj:2qhr
PDBsum2qhr
PubMed18005986
UniProtP01844|LAC2_MOUSE Ig lambda-2 chain C region (Gene Name=Iglc2)

[Back to BioLiP]