Structure of PDB 2ok0 Chain L Binding Site BS01

Receptor Information

>2ok0 Chain L (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DILMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPT
LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIP
LTFGAGTKLEVKRSDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNRNEC

Ligand information

>2ok0 Chain D (length=2) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ok0 Specific recognition of a DNA immunogen by its elicited antibody
Resolution	1.89 Å
Binding residue (original residue number in PDB)	H27D Y32 G91 I94
Binding residue (residue number reindexed from 1)	H31 Y37 G96 I99

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:2ok0, PDBe:2ok0, PDBj:2ok0
PDBsum	2ok0
PubMed	17512945
UniProt	A2NHM3

[Back to BioLiP]