Structure of PDB 2hrp Chain L Binding Site BS01

Receptor Information
>2hrp Chain L (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTVLTQSPASLAVSLGQRATISCRASESVDYYGKSFMNWFQQKPGQPPKL
LIYAASNQGSGVPARFSGSGSGTDFSLHIHPMEEDDSAMYFCQQSKEVPW
TFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hrp Three-dimensional structure of an Fab-peptide complex: structural basis of HIV-1 protease inhibition by a monoclonal antibody.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y27D Y28 K30 F32 S91 K92 V94 W96
Binding residue
(residue number reindexed from 1)		Y31 Y32 K34 F36 S95 K96 V98 W100
External links