Structure of PDB 2f58 Chain L Binding Site BS01

Receptor Information
>2f58 Chain L (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPASLAVSLGQRATISCKASQGVDFDGASFMNWYQQKPGQPPKL
LIFAASTLESGIPARFSGRGSGTDFTLNIHPVEEEDAATYYCQQSHEDPL
TFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2f58 Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing fabs.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
F27D F32 S91 H92 E93 D94 L96
Binding residue
(residue number reindexed from 1)
F31 F36 S95 H96 E97 D98 L100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005615 extracellular space
GO:0019814 immunoglobulin complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2f58, PDBe:2f58, PDBj:2f58
PDBsum2f58
PubMed10368281
UniProtP01666|KV3AE_MOUSE Ig kappa chain V-III region PC 7183

[Back to BioLiP]