Structure of PDB 2b0s Chain L Binding Site BS01

Receptor Information

>2b0s Chain L (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSVLTQPPSASGTPGQRISISCSGTSSNVENNYVYWYQHLPGTAPKLLIY
RNDHRSSGIPDRFSASKSGTSASLAISGLRPEDEGDYYCAAWDDSRGGPD
WVFGGGTKLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV
TVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQ
VTHEGSTVEKTVAPT

Ligand information

>2b0s Chain P (length=16) Species: 11696 (HIV-1 M:B_MN) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KRKRIHIGPGRAFYTT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2b0s Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	N31 Y32 W91 G95A G95B P95C
Binding residue (residue number reindexed from 1)	N32 Y33 W92 G97 G98 P99

External links

PDB	RCSB:2b0s, PDBe:2b0s, PDBj:2b0s
PDBsum	2b0s
PubMed	16731948

[Back to BioLiP]