Structure of PDB 1wav Chain L Binding Site BS01

Receptor Information
>1wav Chain L (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wav Molecular replacement study on form-B monoclinic crystal of insulin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
F25 T27
Binding residue
(residue number reindexed from 1)
F25 T27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1wav, PDBe:1wav, PDBj:1wav
PDBsum1wav
PubMed8760462
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]