Structure of PDB 1tji Chain L Binding Site BS01

Receptor Information
>1tji Chain L (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALQLTQSPSSLSASVGDRITITCRASQGVTSALAWYRQKPGSPPQLLIYD
ASSLESGVPSRFSGSGSGTEFTLTISTLRPEDFATYYCQQLHFYPHTFGG
GTRVDVRRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGEC
Ligand information
>1tji Chain P (length=14) Species: 11708 (Human immunodeficiency virus type 1 (ZAIRE 6 ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EQELLELDKWASLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tji Structure and mechanistic analysis of the Anti-Human Immunodeficiency Virus type 1 antibody 2F5 in complex with its gp41 epitope
Resolution2.2 Å
Binding residue
(original residue number in PDB)		A1 L2 Q27 L91 H92 F93 Y94 H96
Binding residue
(residue number reindexed from 1)		A1 L2 Q27 L91 H92 F93 Y94 H96
External links