Structure of PDB 1sm3 Chain L Binding Site BS01

Receptor Information
>1sm3 Chain L (length=210) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIG
GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFG
GGTKLTVLGSEKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDW
KVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHE
GHTVEKSLSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sm3 Crystal structure at 1.95 A resolution of the breast tumour-specific antibody SM3 complexed with its peptide epitope reveals novel hypervariable loop recognition.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Y32 P56 W91
Binding residue
(residue number reindexed from 1)		Y33 P57 W92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005615 extracellular space
GO:0005886 plasma membrane
GO:0019814 immunoglobulin complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1sm3, PDBe:1sm3, PDBj:1sm3
PDBsum1sm3
PubMed9826510
UniProtP01723|LV1A_MOUSE Ig lambda-1 chain V region

[Back to BioLiP]