Structure of PDB 1qnz Chain L Binding Site BS01

Receptor Information
>1qnz Chain L (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMNWYQQKPGQPPKL
LIYAASNLESGIPARFSGSGSRTDFTLNIHPVEEEDAATYYCQQSNEDPF
TFGSGTKLEIKR
Ligand information
>1qnz Chain P (length=18) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKSIRIQRGPGRAFVTIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qnz NMR Structure of an Anti-Gp120 Antibody Complex with a V3 Peptide Reveals a Surface Important for Co-Receptor Binding
ResolutionN/A
Binding residue
(original residue number in PDB)		Y31 Y36 S95 F100
Binding residue
(residue number reindexed from 1)		Y31 Y36 S95 F100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005615 extracellular space
GO:0019814 immunoglobulin complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1qnz, PDBe:1qnz, PDBj:1qnz
PDBsum1qnz
PubMed10801487
UniProtP01665|KV3AD_MOUSE Ig kappa chain V-III region PC 7043

[Back to BioLiP]