Structure of PDB 1p4b Chain L Binding Site BS01

Receptor Information
>1p4b Chain L (length=110) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGL
IGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWV
FGGGTKLTVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p4b Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		Y40 N69 W109
Binding residue
(residue number reindexed from 1)		Y35 N56 W94
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1p4b, PDBe:1p4b, PDBj:1p4b
PDBsum1p4b
PubMed14754898
UniProtP01723|LV1A_MOUSE Ig lambda-1 chain V region

[Back to BioLiP]