Structure of PDB 1ktr Chain L Binding Site BS01

Receptor Information
>1ktr Chain L (length=229) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DILMTQTPSSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPK
LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP
FTFGSGTKLEIKRGGQVQLQQSGPEDVKPGASVKISCKASGYTFTDYYMN
WVKQSPGKGLEWIGDINPNNGGTSYNQKFKGRATLTVDKSSSTAYMELRS
LTSEDSSVYYCESQSGAYWGQGTTVTVSA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ktr Crystal structure of the anti-His tag antibody 3D5 single-chain fragment complexed to its antigen.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H31 Y37 E39 F94 G96 F101 Y166 N168 D183 E230 S233
Binding residue
(residue number reindexed from 1)		H31 Y37 E39 F94 G96 F101 Y148 N150 D165 E212 S215
External links