Structure of PDB 1kcr Chain L Binding Site BS01

Receptor Information
>1kcr Chain L (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPKSMSMSVGERVTLSCKASENVGTYVSWYQQKPEQSPKLLIYG
ASNRYTGVPDRFTGSGSATDFTLKISSVQAEDLADYHCGQTYSYPTFGGG
TKLAIKRADAAPTVSIFPPSSEQLTAGGASVVCFLNNFYPKDINVKWKID
GSERQNGVANSWTAQDSADSTYSMSSTLTLTKDEYERHNSYTCEATHKTS
TSPIVKSFNRNEC
Ligand information
>1kcr Chain P (length=15) Species: 489454 (Hepatitis B virus genotype A1 subtype adw2 (Isolate South Africa/84/2001)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HQLDPAFGANSTNPD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kcr Crystal structure of an antibody bound to an immunodominant peptide epitope: novel features in peptide-antibody recognition.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D1 E27 Y32 T91 Y92 S93 Y94
Binding residue
(residue number reindexed from 1)		D1 E27 Y32 T91 Y92 S93 Y94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030183 B cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005886 plasma membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kcr, PDBe:1kcr, PDBj:1kcr
PDBsum1kcr
PubMed11120821
UniProtP01837|IGKC_MOUSE Immunoglobulin kappa constant (Gene Name=Igkc)

[Back to BioLiP]