Structure of PDB 1kc5 Chain L Binding Site BS01

Receptor Information
>1kc5 Chain L (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPKSMSMSVGEKVTLSCKASENVDTYVSWYQQRPEQPPALLIYG
ASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQSYSYPLTFGG
GTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKI
DGSERQNGVANSWTAQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPVVKSFNRNEC
Ligand information
>1kc5 Chain P (length=8) Species: 489454 (Hepatitis B virus genotype A1 subtype adw2 (Isolate South Africa/84/2001)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HQLDPAFG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kc5 Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y32 S91 Y92 L96
Binding residue
(residue number reindexed from 1)		Y32 S91 Y92 L96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030183 B cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005886 plasma membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kc5, PDBe:1kc5, PDBj:1kc5
PDBsum1kc5
PubMed11859128
UniProtP01837|IGKC_MOUSE Immunoglobulin kappa constant (Gene Name=Igkc)

[Back to BioLiP]