Structure of PDB 1i8m Chain L Binding Site BS01

Receptor Information
>1i8m Chain L (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYN
AKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGA
GTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKI
DGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPIVKSFNRNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i8m Crystal Structure of an Antigen-Binding Fragment Bound to Single-Stranded DNA
Resolution2.1 Å
Binding residue
(original residue number in PDB)
Y32 Y49 N50 H91 Y92
Binding residue
(residue number reindexed from 1)
Y32 Y49 N50 H91 Y92
Binding affinityPDBbind-CN: Kd=2700nM
Enzymatic activity
Enzyme Commision number ?
External links