Structure of PDB 1ggi Chain L Binding Site BS01

Receptor Information
>1ggi Chain L (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPGSLAVSLGQRATISCRASESVDDDGNSFLHWYQQKPGQPPKL
LIYRSSNLISGIPDRFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPL
TFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ggi Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, 50.1, in complex with its V3 loop peptide antigen.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H34 Y49 Q89 L96
Binding residue
(residue number reindexed from 1)		H38 Y53 Q93 L100
External links